| Primary information |
|---|
| sequence ID | Seq_4175 |
| Peptide sequence | KFSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQ |
| CancerPDF_ID | CancerPDF_ID2014, |
| PMID | 21136997 |
| Protein Name | Zyxin |
| UniprotKB Entry Name | ZYX_HUMAN |
| Fluid | Serum |
| M/Z | 4064.96167 |
| Charge | 1 |
| Profiling Technique | LC-MS |
| Peptide Identification technique | LC-MS-MS/MS |
| Quantification Technique | LC-ESI-MS |
| Labelled/Label Free | Label Free |
| CancerPDF_ID | CancerPDF_ID2014, |
| p-Value | NA |
| Software | MASCOT(v. 2.2.01) |
| Length | 41 |
| Cancer Type | Colorectal cancer |
| Database | SwissProt Database |
| Modification | NA |
| Number of Patients | 30 patients and 30 healthy controls |
| Regulation | NA |
| Validation | Leave One out Cross validation |
| Sensitivity | NA |
| Specificity | NA |
| Accuracy | NA |
| Peptide Atlas | NA |
| IEDB | NA |