Primary information |
---|
sequence ID | Seq_7383 |
Peptide sequence | SLWLQSQPHFCCFWLTVTFPPPLQTHRELAQSSHAQR |
CancerPDF_ID | CancerPDF_ID3403, |
PMID | 24565027 |
Protein Name | NT-3 growth factor receptor |
UniprotKB Entry Name | NTRK3_HUMAN |
Fluid | Plasma |
Profiling Technique | Linear ion-trap mass spectrometer (LTQ) coupled with a Surveyor HPLC-MS |
Peptide Identification technique | MS/MS |
Labelled/Label Free | Label Free |
FDR | 0.05 |
CancerPDF_ID | CancerPDF_ID3403, |
p-Value | less than 0.05 |
Software | SEQUEST and OMSSA |
Length | 37 |
Cancer Type | Breast cancer |
Database | SASD (Synthetic Alternative Splicing Database) |
Modification | NA |
Number of Patients | 40 cancer patients for each training and testing set; 40 normal individuals for each training and testing set |
Regulation | Differentially expressed between normal and patients |
Validation | Independent validation |
Sensitivity | NA |
Specificity | NA |
Accuracy | NA |
Peptide Atlas | NA |
IEDB | NA |