| Primary information |
|---|
| sequence ID | Seq_9170 |
| Peptide sequence | VLSPADKTNVKAAWGKVGAHAGEYGAEALERMF |
| CancerPDF_ID | CancerPDF_ID243, CancerPDF_ID10710, |
| PMID | 19728888,21805675 |
| Protein Name | Hemoglobin alpha,Hemoglobin subunit alpha |
| UniprotKB Entry Name | HBA_HUMAN,HBA_HUMAN |
| Fluid | Serum,Urine |
| M/Z | 3473.7545,3473.7931 |
| Charge | NA,NA |
| Mass (in Da) | NA,NA |
| fdr | NA,NA |
| Profiling Technique | MALDI-TOF,MALDI-TOF |
| Peptide Identification technique | LC-MS/MS,MALDI-TOF-MS |
| Quantification Technique | NA,NA |
| Labelled/Label Free | Label Free,Label Free |
| FDR | NA,1 |
| CancerPDF_ID | CancerPDF_ID243, CancerPDF_ID10710, |
| p-Value | less than 0.05,NA |
| Software | MASCOT(v 2.0.04 for Windows),NA |
| Length | 33,33 |
| Cancer Type | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy",Muscle-invasive bladder cancer |
| Database | SwissProt Database (release 54.7),SwissProt Database |
| Modification | NA,NA |
| Number of Patients | "27 patients, 13 normal individuals",751 bladder cancer and 127 control |
| Regulation | Signature peptide that can Differentiate between NSCLC patients and healthy volunteers,Differentially expressed between cancer vs normal samples |
| Validation | Independent validation,Mann-Whitney tests and areas under receiver-operator characteristic |
| Sensitivity | 1,NA |
| Specificity | 0.96,NA |
| Accuracy | 0.98,NA |
| Peptide Atlas | NA |
| IEDB | 144531
|