| Primary information |
|---|
| CancerPDF_ID | CancerPDF_ID11091 |
| PMID | 26482227 |
| Peptide Sequence | NA |
| Peptide Sequence in Publication | STHGKFHGTVKAENGKLVINGNPITIFQERDPSK |
| Protein Name | G3P_HUMAN |
| UniprotKB Entry Name | G3P_HUMAN |
| Biofluid | Urine |
| M/Z | 3723.84 |
| Charge | NA |
| Mass/H+ | NA |
| Mass (in Daltons) | NA |
| Profiling Technique | MALDI-TOF |
| Peptide Identification Technique | LC-ESI-MS/MS |
| Quantification Technique | NA |
| Labeling | Label Free |
| FDR | FDR less than 5 % |
| p-Value | NA |
| Software | MASCOT |
| Length of Peptide | NA |
| Cancer Type | Clear cell renal carcinoma |
| Database for Peptide search | SwissProt Database |
| Modification | NA |
| Number of Patients | "117 clear cell RCC patients (ccRCC) (72 men, 45 women)" |
| Regulation/Differential Expression | Downregulated with increse in tumor mass |
| Validation | external cross validation not done |
| Sensitivity | NA |
| Specificity | NA |
| Accuracy | NA |
| Secondary information |
|---|
| Peptide Atlas | NA |
| IEDB | |