| Primary information |
|---|
| CancerPDF_ID | CancerPDF_ID241 |
| PMID | 19728888 |
| Peptide Sequence | VLSPADKTNVKAAWGKVGAHAGEYGAEALERM |
| Peptide Sequence in Publication | VLSPADKTNVKAAWGKVGAHAGEYGAEALERM |
| Protein Name | Hemoglobin alpha |
| UniprotKB Entry Name | HBA_HUMAN |
| Biofluid | Serum |
| M/Z | 3326.6863 |
| Charge | NA |
| Mass/H+ | NA |
| Mass (in Daltons) | NA |
| Profiling Technique | MALDI-TOF |
| Peptide Identification Technique | LC-MS/MS |
| Quantification Technique | NA |
| Labeling | Label Free |
| FDR | NA |
| p-Value | less than 0.01 |
| Software | MASCOT(v 2.0.04 for Windows) |
| Length of Peptide | 32 |
| Cancer Type | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" |
| Database for Peptide search | SwissProt Database (release 54.7) |
| Modification | NA |
| Number of Patients | "27 patients, 13 normal individuals" |
| Regulation/Differential Expression | Signature peptide that can Differentiate between NSCLC patients and healthy volunteers |
| Validation | Independent validation |
| Sensitivity | 1 |
| Specificity | 0.96 |
| Accuracy | 0.98 |
| Secondary information |
|---|
| Peptide Atlas | NA |
| IEDB | 144530
144531
|