| Primary information |
|---|
| CancerPDF_ID | CancerPDF_ID3791 |
| PMID | 27026199 |
| Peptide Sequence | VLSPADKTNVKAAWGKVGAHAGEYGAEALER |
| Peptide Sequence in Publication | VLSPADKTNVKAAWGKVGAHAGEYGAEALER |
| Protein Name | Hemoglobin subunit alpha |
| UniprotKB Entry Name | HBA_HUMAN |
| Biofluid | Urine |
| M/Z | NA |
| Charge | NA |
| Mass/H+ | NA |
| Mass (in Daltons) | 3194.65 |
| Profiling Technique | "CE-MS, Micro-TOF-MS" |
| Peptide Identification Technique | MS-MS |
| Quantification Technique | NA |
| Labeling | Label Free |
| FDR | NA |
| p-Value | less than 0.001 |
| Software | Proteome Discoverer 1.2 |
| Length of Peptide | 31 |
| Cancer Type | Bladder cancer |
| Database for Peptide search | Uniprot Human non-redundant Database |
| Modification | NA |
| Number of Patients | 425 for training(109 patients with Recurrent UBC cases and 316 negative for recurrence controls) and 211 for validation (55 UBC recurrent cases and 156 recurrent controls) |
| Regulation/Differential Expression | Differentially expressed between recurrence of UBC vs recurrence control |
| Validation | Independent Validation |
| Sensitivity | For testing dataset 88% |
| Specificity | For testing dataset 51% |
| Accuracy | NA |
| Secondary information |
|---|
| Peptide Atlas | PeptideAtlas |
| IEDB | 120290
144530
144531
|