| Primary information |
|---|
| CancerPDF_ID | CancerPDF_ID3956 |
| PMID | 22809520 |
| Peptide Sequence | RGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGR |
| Peptide Sequence in Publication | RGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGR |
| Protein Name | Submaxillary gland androgen-regulated protein 3B |
| UniprotKB Entry Name | SMR3B_HUMAN |
| Biofluid | Saliva |
| M/Z | NA |
| Charge | NA |
| Mass/H+ | NA |
| Mass (in Daltons) | 3561.91 |
| Profiling Technique | LC-MS and iTRAQ |
| Peptide Identification Technique | MS/MS |
| Quantification Technique | "2,4,6-trinitrobenzenesulfonic acid assay" |
| Labeling | Labelled |
| FDR | NA |
| p-Value | NA |
| Software | MASCOT (v2.1.1) |
| Length of Peptide | 32 |
| Cancer Type | Normal |
| Database for Peptide search | SwissProt Database (release date 010111) |
| Modification | iTRAQ8plexatN-term |
| Number of Patients | NA |
| Regulation/Differential Expression | NA |
| Validation | NA |
| Sensitivity | NA |
| Specificity | NA |
| Accuracy | NA |
| Secondary information |
|---|
| Peptide Atlas | PeptideAtlas |
| IEDB | |