Primary information |
---|
CancerPDF_ID | CancerPDF_ID55 |
PMID | 16896061 |
Peptide Sequence | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF |
Peptide Sequence in Publication | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF. |
Protein Name | Inter-alpha-trypsin inhibitor heavy chain H13 |
UniprotKB Entry Name | ITIH4_HUMAN |
Biofluid | Serum |
M/Z | 3272.5 |
Charge | 1 |
Mass/H+ | 3272.63 |
Mass (in Daltons) | NA |
Profiling Technique | MALDI-TOF |
Peptide Identification Technique | Q/TOF MS/MS |
Quantification Technique | NA |
Labeling | Label Free |
FDR | NA |
p-Value | 1.00E-05 |
Software | MASCOT |
Length of Peptide | 30 |
Cancer Type | Metastatic thyroid carcinomas |
Database for Peptide search | NCBI refseq Protein Database |
Modification | NA |
Number of Patients | 40 metastatic thyroid carcinoma patients and 40 normal for training phase and 10 metastatic thyroid carcinoma and 10 normal individuals for independent validation |
Regulation/Differential Expression | NA |
Validation | Independent validation |
Sensitivity | 95% on independent dataset |
Specificity | 95% on independent dataset |
Accuracy | NA |
Secondary information |
---|
Peptide Atlas | NA |
IEDB | |