| Primary information |
|---|
| CancerPDF_ID | CancerPDF_ID55 |
| PMID | 16896061 |
| Peptide Sequence | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF |
| Peptide Sequence in Publication | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF. |
| Protein Name | Inter-alpha-trypsin inhibitor heavy chain H13 |
| UniprotKB Entry Name | ITIH4_HUMAN |
| Biofluid | Serum |
| M/Z | 3272.5 |
| Charge | 1 |
| Mass/H+ | 3272.63 |
| Mass (in Daltons) | NA |
| Profiling Technique | MALDI-TOF |
| Peptide Identification Technique | Q/TOF MS/MS |
| Quantification Technique | NA |
| Labeling | Label Free |
| FDR | NA |
| p-Value | 1.00E-05 |
| Software | MASCOT |
| Length of Peptide | 30 |
| Cancer Type | Metastatic thyroid carcinomas |
| Database for Peptide search | NCBI refseq Protein Database |
| Modification | NA |
| Number of Patients | 40 metastatic thyroid carcinoma patients and 40 normal for training phase and 10 metastatic thyroid carcinoma and 10 normal individuals for independent validation |
| Regulation/Differential Expression | NA |
| Validation | Independent validation |
| Sensitivity | 95% on independent dataset |
| Specificity | 95% on independent dataset |
| Accuracy | NA |
| Secondary information |
|---|
| Peptide Atlas | NA |
| IEDB | |