| Primary information |
|---|
| CancerPDF_ID | CancerPDF_ID8564 |
| PMID | 23667664 |
| Peptide Sequence | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF |
| Peptide Sequence in Publication | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF |
| Protein Name | Inter-alpha-trypsin inhibitor heavy chain H4 |
| UniprotKB Entry Name | ITIH4_HUMAN |
| Biofluid | Serum |
| M/Z | 3271.63 |
| Charge | 1 |
| Mass/H+ | 3274.73 |
| Mass (in Daltons) | NA |
| Profiling Technique | MALDI-TOF |
| Peptide Identification Technique | FT-ICR MS/MS + nano-HPLC |
| Quantification Technique | NA |
| Labeling | Label Free |
| FDR | NA |
| p-Value | NA |
| Software | MASCOT |
| Length of Peptide | 30 |
| Cancer Type | "Breast cancer, Lung cancer, Rectal cancer" |
| Database for Peptide search | NA |
| Modification | NA |
| Number of Patients | "Breast Cancer =84, lung cancer= 70, Rectal cancer = 30patients; 500 healthy" |
| Regulation/Differential Expression | NA |
| Validation | NA |
| Sensitivity | NA |
| Specificity | NA |
| Accuracy | NA |
| Secondary information |
|---|
| Peptide Atlas | NA |
| IEDB | |