Primary information |
---|
CancerPDF_ID | CancerPDF_ID8564 |
PMID | 23667664 |
Peptide Sequence | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF |
Peptide Sequence in Publication | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF |
Protein Name | Inter-alpha-trypsin inhibitor heavy chain H4 |
UniprotKB Entry Name | ITIH4_HUMAN |
Biofluid | Serum |
M/Z | 3271.63 |
Charge | 1 |
Mass/H+ | 3274.73 |
Mass (in Daltons) | NA |
Profiling Technique | MALDI-TOF |
Peptide Identification Technique | FT-ICR MS/MS + nano-HPLC |
Quantification Technique | NA |
Labeling | Label Free |
FDR | NA |
p-Value | NA |
Software | MASCOT |
Length of Peptide | 30 |
Cancer Type | "Breast cancer, Lung cancer, Rectal cancer" |
Database for Peptide search | NA |
Modification | NA |
Number of Patients | "Breast Cancer =84, lung cancer= 70, Rectal cancer = 30patients; 500 healthy" |
Regulation/Differential Expression | NA |
Validation | NA |
Sensitivity | NA |
Specificity | NA |
Accuracy | NA |
Secondary information |
---|
Peptide Atlas | NA |
IEDB | |