| Primary information |
|---|
| CancerPDF_ID | CancerPDF_ID9945 |
| PMID | 21124649 |
| Peptide Sequence | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF |
| Peptide Sequence in Publication | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF |
| Protein Name | Inter-alpha-trypsin inhibitor heavy chain H4 |
| UniprotKB Entry Name | ITIH4_HUMAN |
| Biofluid | Serum |
| M/Z | NA |
| Charge | NA |
| Mass/H+ | NA |
| Mass (in Daltons) | NA |
| Profiling Technique | LC-MS |
| Peptide Identification Technique | LC-ESI-MS/MS |
| Quantification Technique | NA |
| Labeling | Labelled |
| FDR | NA |
| p-Value | less than 0.05 |
| Software | NA |
| Length of Peptide | 30 |
| Cancer Type | Breast cancer |
| Database for Peptide search | NCBI Protein Database |
| Modification | ITIH4-30 |
| Number of Patients | 9 BC and 9 control |
| Regulation/Differential Expression | Differentially expressed between cancer vs control |
| Validation | NA |
| Sensitivity | NA |
| Specificity | NA |
| Accuracy | NA |
| Secondary information |
|---|
| Peptide Atlas | NA |
| IEDB | |