Primary information |
---|
CancerPDF_ID | CancerPDF_ID9953 |
PMID | 21137033 |
Peptide Sequence | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF |
Peptide Sequence in Publication | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF |
Protein Name | Inter-alpha-trypsin inhibitor heavy chain H4 |
UniprotKB Entry Name | ITIH4_HUMAN |
Biofluid | Serum |
M/Z | NA |
Charge | NA |
Mass/H+ | NA |
Mass (in Daltons) | NA |
Profiling Technique | LC-MS |
Peptide Identification Technique | LC-MS/MS |
Quantification Technique | NA |
Labeling | Labelled |
FDR | NA |
p-Value | less than 0.05 |
Software | NA |
Length of Peptide | 30 |
Cancer Type | Breast cancer |
Database for Peptide search | NA |
Modification | ITIH4-30 |
Number of Patients | 45 BC and 78 control |
Regulation/Differential Expression | Differentially expressed between cancer vs control |
Validation | NA |
Sensitivity | NA |
Specificity | NA |
Accuracy | NA |
Secondary information |
---|
Peptide Atlas | NA |
IEDB | |