A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11241 |
| Swiss-prot Accession number | P01142 (Sequence in FASTA format) |
| Description | Corticoliberin precursor (Corticotropin-releasing factor) (CRF)(Corticotropin-releasing hormone) (Endorpholiberin). |
| Source organism | Ovis aries (Sheep) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | This hormone from hypothalamus regulates the release of corticotropin from pituitary gland |
| Protein Length | 190 Amino acids |
| Molecular weight | 20672 |
| References | 1 PubMed abstract 6600512 2 PubMed abstract 3265687 3 PubMed abstract 6273874 4 PubMed abstract 6267699 5 PubMed abstract 2647152 |
| Domain Name | CRF |
| Hormone Name | Corticoliberin |
| Mature Hormone Sequence | SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA |
| Position of mature hormone in Pre-Hormone protein | 41 Residues from position (148-188) |
| Receptor | O62772
Detail in HMRbase |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |