A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11302 |
| Swiss-prot Accession number | P01218 (Sequence in FASTA format) |
| Description | Glycoprotein hormones alpha chain precursor (Anterior pituitaryglycoprotein hormones common subunit alpha) (Follitropin alpha chain)(Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alphachain) (LH alpha 3) (Luteinizing hormone alpha chain) (LSH-alpha)(Thyrotropin alpha chain) (Thyroid-stimulating hormone alpha chain)(TSH-alpha) [Contains: LH alpha 1-1; LH alpha 1-2; LH alpha 1-3]. |
| Source organism | Ovis aries (Sheep) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | N/A |
| Protein Length | 120 Amino acids |
| Molecular weight | 13588 |
| References | 1 PubMed abstract 2481272 2 PubMed abstract 5064343 3 PubMed abstract 4676903 4 PubMed abstract 6798968 5 PubMed abstract 2456202 6 Chung D., Sairam M.R., Li C.H.; "The primary structure of ovine interstitial cell-stimulating hormone.III. Disulfide bridges of the alpha-subunit."; Arch. Biochem. Biophys. 159:678-682(1973). 7 PubMed abstract 2209620 8 PubMed abstract 2481272 9 PubMed abstract 5064343 10 PubMed abstract 4676903 11 PubMed abstract 6798968 12 PubMed abstract 2456202 13 Chung D., Sairam M.R., Li C.H.; "The primary structure of ovine interstitial cell-stimulating hormone.III. Disulfide bridges of the alpha-subunit."; Arch. Biochem. Biophys. 159:678-682(1973). 14 PubMed abstract 2209620 |
| Domain Name | Hormone_6 |
| Hormone Name | Glycoprotein hormones alpha chain |
| Mature Hormone Sequence | FPDGEFTMQGCPECKLKENKYFSKPDAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNVRVENHTECHCSTCYYHKS |
| Position of mature hormone in Pre-Hormone protein | 96 Residues from position (25-120) |
| Receptor | P35379 Detail in HMRbase Q28585 Detail in HMRbase P56495 Detail in HMRbase |
| Gene ID | 443538 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |