A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11304 |
| Swiss-prot Accession number | P01220 (Sequence in FASTA format) |
| Description | Glycoprotein hormones alpha chain precursor (Anterior pituitaryglycoprotein hormones common subunit alpha) (Follitropin alpha chain)(Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alphachain) (Luteinizing hormone alpha chain) (LSH-alpha) (Thyrotropinalpha chain) (Thyroid-stimulating hormone alpha chain) (TSH-alpha). |
| Source organism | Equus caballus (Horse) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | N/A |
| Protein Length | 120 Amino acids |
| Molecular weight | 13809 |
| References | 1 Min K., Shinozaki M., Miyazawa K., Nishimura R., Sasaki N., Shiota K.,Ogawa T.; "Nucleotide sequence of eCG alpha-subunit cDNA and its expression inthe equine placenta."; J. Reprod. Dev. 40:301-305(1994).
2 PubMed abstract 3437252 3 Moore W.T. Jr., Ward D.N., Burleigh B.D.; "Primary structure of pregnant mare serum gonadotropin alphasubunit."; Fed. Proc. 38:462-462(1979). 4 PubMed abstract 670201 5 Min K., Shinozaki M., Miyazawa K., Nishimura R., Sasaki N., Shiota K.,Ogawa T.; "Nucleotide sequence of eCG alpha-subunit cDNA and its expression inthe equine placenta."; J. Reprod. Dev. 40:301-305(1994). 6 PubMed abstract 3437252 7 Moore W.T. Jr., Ward D.N., Burleigh B.D.; "Primary structure of pregnant mare serum gonadotropin alphasubunit."; Fed. Proc. 38:462-462(1979). 8 PubMed abstract 670201 |
| Domain Name | Hormone_6 |
| Hormone Name | Glycoprotein hormones alpha chain |
| Mature Hormone Sequence | FPDGEFTTQDCPECKLRENKYFFKLGVPIYQCKGCCFSRAYPTPARSRKTMLVPKNITSESTCCVAKAFIRVTVMGNIKLENHTQCYCSTCYHHKI |
| Position of mature hormone in Pre-Hormone protein | 96 Residues from position (25-120) |
| Receptor | P47799
Detail in HMRbase |
| Gene ID | 100034174 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |