A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11311 |
| Swiss-prot Accession number | P01229 (Sequence in FASTA format) |
| Description | Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain). |
| Source organism | Homo sapiens (Human) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | Pituitary gland |
| Post translational modification | N/A |
| Function | Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids |
| Protein Length | 141 Amino acids |
| Molecular weight | 15345 |
| References | 1 PubMed abstract 6690982 2 PubMed abstract 1191677 3 PubMed abstract 4685398 4 PubMed abstract 4719207 5 PubMed abstract 1991473 6 PubMed abstract 1495492 7 PubMed abstract 1727547 8 PubMed abstract 9457942 9 PubMed abstract 9886510 10 PubMed abstract 11870227 |
| Domain Name | Cys_knot |
| Hormone Name | Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta) |
| Mature Hormone Sequence | SREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL |
| Position of mature hormone in Pre-Hormone protein | 121 Residues from position (21-141) |
| Receptor | P22888
Detail in HMRbase |
| Gene ID | 3972 |
| PDB ID | 1M92 |
| Drugpedia | wiki |
| Comments |