A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11315 |
| Swiss-prot Accession number | P01237 (Sequence in FASTA format) |
| Description | Prolactin precursor (PRL). |
| Source organism | Rattus norvegicus (Rat) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Prolactin acts primarily on the mammary gland by promoting lactation |
| Protein Length | 226 Amino acids |
| Molecular weight | 25753 |
| References | 1 PubMed abstract 6283362 2 PubMed abstract 6251061 3 PubMed abstract 6993473 4 Shaw-Bruha C.M., Pennington K.L., Shull J.D.; Submitted (OCT-1997) to the EMBL/GenBank/DDBJ databases. 5 PubMed abstract 728396 6 PubMed abstract 925136 |
| Domain Name | Hormone_1 |
| Hormone Name | Prolactin |
| Mature Hormone Sequence | LPVCSGGDCQTPLPELFDRVVMLSHYIHTLYTDMFIEFDKQYVQDREFIAKAINDCPTSSLATPEDKEQAQKVPPEVLLNLILSLVHSWNDPLFQLITGLGGIHEAPDAIISRAKEIEEQNKRLLEGIEKIISQAYPEAKGNEIYLVWSQLPSLQGVDEESKDLAFYNNIRCLRRDSHKVDNYLKFLRCQIVHKNNC |
| Position of mature hormone in Pre-Hormone protein | 197 Residues from position (30-226) |
| Receptor | P05710
Detail in HMRbase |
| Gene ID | 24683 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |