A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11317 |
| Swiss-prot Accession number | P01239 (Sequence in FASTA format) |
| Description | Prolactin precursor (PRL). |
| Source organism | Bos taurus (Bovine) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Prolactin acts primarily on the mammary gland by promoting lactation |
| Protein Length | 229 Amino acids |
| Molecular weight | 25793 |
| References | 1 PubMed abstract 6274859 2 Cao X., Huang S.Z., Ren Z.R., Zeng Y.T.; Submitted (SEP-2001) to the EMBL/GenBank/DDBJ databases. 3 PubMed abstract 6299665 4 PubMed abstract 6897772 5 Rubtsov P.M., Oganesyan R.G., Gorbulev V.G., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones. II. Possible polymorphism ofpreprolactin in cattle. Data of molecular cloning."; Mol. Biol. (Mosk.) 22:117-127(1988). 6 PubMed abstract 4608931 7 PubMed abstract 5507606 8 PubMed abstract 8250856 |
| Domain Name | Hormone_1 |
| Hormone Name | Prolactin |
| Mature Hormone Sequence | TPVCPNGPGNCQVSLRDLFDRAVMVSHYIHDLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGAPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDEDARYSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC |
| Position of mature hormone in Pre-Hormone protein | 199 Residues from position (31-229) |
| Receptor | Q28172
Detail in HMRbase |
| Gene ID | 280901 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |