A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10296 |
| Swiss-prot Accession number | P01257 (Sequence in FASTA format) |
| Description | Calcitonin precursor. |
| Source organism | Rattus norvegicus (Rat) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the calcitonin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones |
| Protein Length | 136 Amino acids |
| Molecular weight | 15103 |
| References | 1 PubMed abstract 6264603 2 PubMed abstract 6400492 3 PubMed abstract 6933496 4 PubMed abstract 1278175 |
| Domain Name | Calc_CGRP_IAPP |
| Hormone Name | Calcitonin |
| Mature Hormone Sequence | CGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP |
| Position of mature hormone in Pre-Hormone protein | 32 Residues from position (85-116) |
| Receptor | P32214
Detail in HMRbase |
| Gene ID | 24241 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |