A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11323 |
| Swiss-prot Accession number | P01258 (Sequence in FASTA format) |
| Description | Calcitonin precursor [Contains: Calcitonin; Katacalcin (Calcitonincarboxyl-terminal peptide) (CCP) (PDN-21)]. |
| Source organism | Homo sapiens (Human) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the calcitonin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Calcitonin causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones |
| Protein Length | 141 Amino acids |
| Molecular weight | 15467 |
| References | 1 PubMed abstract 6546550 2 PubMed abstract 3872459 3 PubMed abstract 3485540 4 PubMed abstract 3034287 5 PubMed abstract 2571128 6 PubMed abstract 1761559 7 Livingston R.J., Rieder M.J., Shaffer T., Bertucci C., Baier C.N.,Rajkumar N., Willa H.T., Daniels M., Downing T.K., Stanaway I.B.,Nguyen C.P., Gildersleeve H., Cassidy C.M., Johnson E.J.,Swanson J.E., McFarland I., Yool B., Park C., Nickerson D.A.; "NIEHS-SNPs, environmental genome project, NIEHS ES15478, Departmentof Genome Sciences, Seattle, WA (URL: http://egp.gs.washington.edu)."; Submitted (MAY-2005) to the EMBL/GenBank/DDBJ databases. 8 PubMed abstract 15489334 9 PubMed abstract 2408883 10 PubMed abstract 6148938 11 PubMed abstract 5760861 12 PubMed abstract 2001366 13 PubMed abstract 6132180 14 PubMed abstract 14759258 |
| Domain Name | Calc_CGRP_IAPP |
| Hormone Name | Calcitonin |
| Mature Hormone Sequence | CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP |
| Position of mature hormone in Pre-Hormone protein | 32 Residues from position (85-116) |
| Receptor | P30988
Detail in HMRbase |
| Gene ID | 796 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |
| HMRbase accession number | 11324 |
| Swiss-prot Accession number | P01258 (Sequence in FASTA format) |
| Description | Calcitonin precursor [Contains: Calcitonin; Katacalcin (Calcitonincarboxyl-terminal peptide) (CCP) (PDN-21)]. |
| Source organism | Homo sapiens (Human) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the calcitonin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Katacalcin is a potent plasma calcium-lowering peptide |
| Protein Length | 141 Amino acids |
| Molecular weight | 15467 |
| References | 1 PubMed abstract 6546550 2 PubMed abstract 3872459 3 PubMed abstract 3485540 4 PubMed abstract 3034287 5 PubMed abstract 2571128 6 PubMed abstract 1761559 7 Livingston R.J., Rieder M.J., Shaffer T., Bertucci C., Baier C.N.,Rajkumar N., Willa H.T., Daniels M., Downing T.K., Stanaway I.B.,Nguyen C.P., Gildersleeve H., Cassidy C.M., Johnson E.J.,Swanson J.E., McFarland I., Yool B., Park C., Nickerson D.A.; "NIEHS-SNPs, environmental genome project, NIEHS ES15478, Departmentof Genome Sciences, Seattle, WA (URL: http://egp.gs.washington.edu)."; Submitted (MAY-2005) to the EMBL/GenBank/DDBJ databases. 8 PubMed abstract 15489334 9 PubMed abstract 2408883 10 PubMed abstract 6148938 11 PubMed abstract 5760861 12 PubMed abstract 2001366 13 PubMed abstract 6132180 14 PubMed abstract 14759258 |
| Domain Name | Calc_CGRP_IAPP |
| Hormone Name | Katacalcin |
| Mature Hormone Sequence | DMSSDLERDHRPHVSMPQNAN |
| Position of mature hormone in Pre-Hormone protein | 21 Residues from position (121-141) |
| Receptor | P30988
Detail in HMRbase |
| Gene ID | 796 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |