A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11326 |
| Swiss-prot Accession number | P01268 (Sequence in FASTA format) |
| Description | Parathyroid hormone precursor (Parathyrin) (PTH). |
| Source organism | Bos taurus (Bovine) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the parathyroid hormone family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion |
| Protein Length | 115 Amino acids |
| Molecular weight | 12980 |
| References | 1 PubMed abstract 388425 2 PubMed abstract 6170060 3 PubMed abstract 6185374 4 PubMed abstract 6086460 5 PubMed abstract 4522780 6 PubMed abstract 5531031 7 PubMed abstract 5275384 8 PubMed abstract 4322265 9 PubMed abstract 10623601 |
| Domain Name | Parathyroid |
| Hormone Name | Parathyroid hormone (Parathyrin) (PTH) |
| Mature Hormone Sequence | AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNFVALGASIAYRDGSSQRPRKKEDNVLVESHQKSLGEADKADVDVLIKAKPQ |
| Position of mature hormone in Pre-Hormone protein | 84 Residues from position (32-115) |
| Receptor | Q1LZF7
Detail in HMRbase |
| Gene ID | 280903 |
| PDB ID | 1ZWC |
| Drugpedia | wiki |
| Comments |