A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11361 |
| Swiss-prot Accession number | P04089 (Sequence in FASTA format) |
| Description | Parathyroid hormone precursor (Parathyrin) (PTH). |
| Source organism | Rattus norvegicus (Rat) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the parathyroid hormone family. |
| Tissue Specificity | Hypothalamus and parathyroid gland |
| Post translational modification | N/A |
| Function | PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion |
| Protein Length | 115 Amino acids |
| Molecular weight | 12722 |
| References | 1 PubMed abstract 6321505 2 PubMed abstract 3628009 3 Schmelzer H.J., Gross G., Mayer H.; "Nucleotide sequence of cloned cDNA encoding rat prepro parathyroidhormone."; Adv. Gene Technol. 21:228-229(1984). 4 PubMed abstract 7588314 |
| Domain Name | Parathyroid |
| Hormone Name | Parathyroid hormone (Parathyrin) (PTH) |
| Mature Hormone Sequence | AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNFVSLGVQMAAREGSYQRPTKKEENVLVDGNSKSLGEGDKADVDVLVKAKSQ |
| Position of mature hormone in Pre-Hormone protein | 84 Residues from position (32-115) |
| Receptor | P25961
Detail in HMRbase |
| Gene ID | 24694 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |