A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11394 |
| Swiss-prot Accession number | P09321 (Sequence in FASTA format) |
| Description | Prolactin-3B1 precursor (Chorionic somatomammotropin hormone 2)(Placental lactogen II) (PL-II) (RPLII). |
| Source organism | Rattus norvegicus (Rat) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
| Subcellular location | Secreted |
| Developmental Stage | Placental lactogen II is expressed from days 12 to term of pregnancy. |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | N/A |
| Protein Length | 221 Amino acids |
| Molecular weight | 25007 |
| References | 1 PubMed abstract 2874144 2 PubMed abstract 9492027 3 PubMed abstract 15489334 4 PubMed abstract 2874144 5 PubMed abstract 9492027 6 PubMed abstract 15489334 |
| Domain Name | Hormone_1 |
| Hormone Name | Prolactin-3B1 |
| Mature Hormone Sequence | APNYRMSTGSLYQRVVELSHYTHDLASKVFIEFDMKFGRTVWTHNLMLSPCHTAAIPTPENSEQVHQAKSEDLLKVSITILQAWQEPLKHIVAAVATLPDGSDTLLSRTKELEERIQGLLEGLETILSRVQPGAVGSDYTFWSEWSDLQSSDKSTKNGVLSVLYRCMRRDTHKVDNFLKVLKCRDIYNNNC |
| Position of mature hormone in Pre-Hormone protein | 191 Residues from position (31-221) |
| Receptor | P05710
Detail in HMRbase |
| Gene ID | 24283 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |