A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11397 |
| Swiss-prot Accession number | P09916 (Sequence in FASTA format) |
| Description | Somatoliberin precursor (Growth hormone-releasing factor) (GRF)(Growth hormone-releasing hormone) (GHRH). |
| Source organism | Rattus norvegicus (Rat) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone |
| Protein Length | 104 Amino acids |
| Molecular weight | 12266 |
| References | 1 PubMed abstract 3920534 2 PubMed abstract 1924334 3 PubMed abstract 7895659 4 PubMed abstract 6406907 |
| Domain Name | Hormone_2 |
| Hormone Name | Somatoliberin |
| Mature Hormone Sequence | HADAIFTSSYRRILGQLYARKLLHEIMNRQQGERNQEQRSRFN |
| Position of mature hormone in Pre-Hormone protein | 43 Residues from position (31-73) |
| Receptor | Q02644
Detail in HMRbase |
| Gene ID | 29446 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |