A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11398 |
| Swiss-prot Accession number | P0C234 (Sequence in FASTA format) |
| Description | Calcitonin. |
| Source organism | Rana catesbeiana (Bull frog) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the calcitonin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones |
| Protein Length | 32 Amino acids |
| Molecular weight | 3426 |
| References | 1 PubMed abstract 9245522 |
| Domain Name | Calc_CGRP_IAPP |
| Hormone Name | Calcitonin |
| Mature Hormone Sequence | CSGLSTCALMKLSQDLHRFNSYPRTNVGAGTP |
| Position of mature hormone in Pre-Hormone protein | 32 Residues from position (1-32) |
| Receptor | Q7SX84
Detail in HMRbase |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |