A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11400 |
| Swiss-prot Accession number | P11919 (Sequence in FASTA format) |
| Description | Eclosion hormone precursor (Ecdysis activator) (EH). |
| Source organism | Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Sphingoidea;Sphingidae; Sphinginae; Manduca. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the insect eclosion hormone family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Neuropeptide that triggers the performance of ecdysis behaviors at the end of a molt. It triggers adult behavior patterns: larval, pupal and adult ecdysis, and plasticization during the molt |
| Protein Length | 88 Amino acids |
| Molecular weight | 9675 |
| References | 1 PubMed abstract 2813382 2 PubMed abstract 3304284 3 PubMed abstract 3609300 4 PubMed abstract 1634328 |
| Domain Name | Eclosion |
| Hormone Name | Eclosion hormone |
| Mature Hormone Sequence | NPAIATGYDPMEICIENCAQCKKMLGAWFEGPLCAESCIKFKGKLIPECEDFASIAPFLNKL |
| Position of mature hormone in Pre-Hormone protein | 62 Residues from position (27-88) |
| Receptor | Q32XW8 Detail in HMRbase Q32XW9 Detail in HMRbase |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |