A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11413 |
| Swiss-prot Accession number | P17572 (Sequence in FASTA format) |
| Description | Prolactin precursor (PRL). |
| Source organism | Meleagris gallopavo (Common turkey) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Meleagris. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | Three forms are found, non-glycosylated, glycosylated and one form seems to be only O-glycosylated. |
| Function | N/A |
| Protein Length | 229 Amino acids |
| Molecular weight | 25854 |
| References | 1 PubMed abstract 8618952 2 PubMed abstract 1879669 3 PubMed abstract 2349117 4 PubMed abstract 1769204 |
| Domain Name | Hormone_1 |
| Hormone Name | Prolactin |
| Mature Hormone Sequence | LPICSSGSVNCQVSLGELFDRAVRLSHYIHFLSSEIFNEFDERYAQGRGFITKAVNGCHTSSLTTPEDKEQTQQIHHEELLNLILGVLRSWNDPLIHLASEVQRIKEAPDTILWKAVEIEEQNKRLLEGMEKIVGRIHSGDAGNEVFSQWDGLPSLQLADEDSRLFAFYNLLHCLRRDSHKIDNYLKVLKCRLIHDNNC |
| Position of mature hormone in Pre-Hormone protein | 199 Residues from position (31-229) |
| Receptor | Q91094
Detail in HMRbase |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |