A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11426 |
| Swiss-prot Accession number | P21702 (Sequence in FASTA format) |
| Description | Prolactin-3D1 precursor (Chorionic somatomammotropin hormone 1)(Placental lactogen I) (PL-I). |
| Source organism | Rattus norvegicus (Rat) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
| Subcellular location | Secreted |
| Developmental Stage | Placental lactogen I is expressed in mid- pregnancy, while placental lactogen II is expressed throughout the later half of pregnancy. |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | N/A |
| Protein Length | 230 Amino acids |
| Molecular weight | 26324 |
| References | 1 PubMed abstract 2373051 2 PubMed abstract 2373051 |
| Domain Name | Hormone_1 |
| Hormone Name | Prolactin-3D1 |
| Mature Hormone Sequence | SKPTAIVSTDDLYHCLVEQSHNTFIMAADVYREFDINFAKRSWMKDRILPLCHTASIHTPENLEEVHEMKTEDFLNSIINVSVSWKEPLKHLVVCSDCSSGASVSMGKKAVDMKDKNLIILEGLQTLYNRTQAKVEENFENFDYPAWSGLKDLDSSDEEHHLFAICNLCRCVKRDIHKIDTYLKVLRCRVVFKNECGVSTF |
| Position of mature hormone in Pre-Hormone protein | 201 Residues from position (30-230) |
| Receptor | P05710
Detail in HMRbase |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |