A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10031 |
| Swiss-prot Accession number | P35454 (Sequence in FASTA format) |
| Description | Oxytocin-neurophysin 1 precursor (OT-NPI) [Contains: Oxytocin(Ocytocin); Neurophysin 1]. |
| Source organism | Mus musculus (Mouse) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
| Subcellular location | N/A |
| Developmental Stage | N/A |
| Similarity | Belongs to the vasopressin/oxytocin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland |
| Protein Length | 125 Amino acids |
| Molecular weight | 12851 |
| References | 1 PubMed abstract 2176709 2 PubMed abstract 11471062 |
| Domain Name | Hormone_5 |
| Hormone Name | Oxytocin |
| Mature Hormone Sequence | CYIQNCPLG |
| Position of mature hormone in Pre-Hormone protein | 9 Residues from position (20-28) |
| Receptor | P97926
Detail in HMRbase |
| Gene ID | 18429 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |
| HMRbase accession number | 11441 |
| Swiss-prot Accession number | P35454 (Sequence in FASTA format) |
| Description | Oxytocin-neurophysin 1 precursor (OT-NPI) [Contains: Oxytocin(Ocytocin); Neurophysin 1]. |
| Source organism | Mus musculus (Mouse) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
| Subcellular location | N/A |
| Developmental Stage | N/A |
| Similarity | Belongs to the vasopressin/oxytocin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Neurophysin 1 specifically binds oxytocin |
| Protein Length | 125 Amino acids |
| Molecular weight | 12851 |
| References | 1 PubMed abstract 2176709 2 PubMed abstract 11471062 |
| Domain Name | Hormone_5 |
| Hormone Name | Neurophysin 1 |
| Mature Hormone Sequence | AVLDLDMRKCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAATGICCSPDGCRTDPACDPESAFSER |
| Position of mature hormone in Pre-Hormone protein | 94 Residues from position (32-125) |
| Receptor | P97926
Detail in HMRbase |
| Gene ID | 18429 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |