A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11496 |
| Swiss-prot Accession number | P69165 (Sequence in FASTA format) |
| Description | Calcitonin-2. |
| Source organism | Oncorhynchus gorbuscha (Pink salmon) (Humpback salmon) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the calcitonin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones |
| Protein Length | 32 Amino acids |
| Molecular weight | 3387 |
| References | 1 Keutmann H.T., Lequin R.M., Habener J.F., Singer F.R., Niall H.D.,Potts J.T. Jr.; "Chemistry and physiology of the calcitonins: some recent advances."; (In) Taylor S. (eds.);Endocrinology 1971: proceedings of the third international symposium,pp.316-323, Heinemann Medical Books, London (1972).
2 PubMed abstract 4508400 |
| Domain Name | Calc_CGRP_IAPP |
| Hormone Name | Calcitonin-2 |
| Mature Hormone Sequence | CSNLSTCVLGKLSQDLHKLQTFPRTNTGAGVP |
| Position of mature hormone in Pre-Hormone protein | 32 Residues from position (1-32) |
| Receptor | Q8AXU4
Detail in HMRbase |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |