A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10305 |
| Swiss-prot Accession number | P81277 (Sequence in FASTA format) |
| Description | Prolactin-releasing peptide precursor (PrRP) (Prolactin-releasinghormone) [Contains: Prolactin-releasing peptide PrRP31; Prolactin-releasing peptide PrRP20]. |
| Source organism | Homo sapiens (Human) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | N/A |
| Tissue Specificity | Medulla oblongata and hypothalamus |
| Post translational modification | N/A |
| Function | Stimulates prolactin (PRL) release and regulates the expression of prolactin through its receptor GPR10. May stimulate lactotrophs directly to secrete PRL |
| Protein Length | 87 Amino acids |
| Molecular weight | 9639 |
| References | 1 PubMed abstract 9607765 2 PubMed abstract 15489334 3 PubMed abstract 10498338 |
| Domain Name | N/A |
| Hormone Name | Prolactin-releasing peptide PrRP31 |
| Mature Hormone Sequence | SRTHRHSMEIRTPDINPAWYASRGIRPVGRF |
| Position of mature hormone in Pre-Hormone protein | 31 Residues from position (23-53) |
| Receptor | P49683
Detail in HMRbase |
| Gene ID | 51052 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |
| HMRbase accession number | 10306 |
| Swiss-prot Accession number | P81277 (Sequence in FASTA format) |
| Description | Prolactin-releasing peptide precursor (PrRP) (Prolactin-releasinghormone) [Contains: Prolactin-releasing peptide PrRP31; Prolactin-releasing peptide PrRP20]. |
| Source organism | Homo sapiens (Human) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | N/A |
| Tissue Specificity | Medulla oblongata and hypothalamus |
| Post translational modification | N/A |
| Function | Stimulates prolactin (PRL) release and regulates the expression of prolactin through its receptor GPR10. May stimulate lactotrophs directly to secrete PRL |
| Protein Length | 87 Amino acids |
| Molecular weight | 9639 |
| References | 1 PubMed abstract 9607765 2 PubMed abstract 15489334 3 PubMed abstract 10498338 |
| Domain Name | N/A |
| Hormone Name | Prolactin-releasing peptide PrRP20 |
| Mature Hormone Sequence | TPDINPAWYASRGIRPVGRF |
| Position of mature hormone in Pre-Hormone protein | 20 Residues from position (34-53) |
| Receptor | P49683
Detail in HMRbase |
| Gene ID | 51052 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |