A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10005
Swiss-prot Accession number	P81278 (Sequence in FASTA format)
Description	Prolactin-releasing peptide precursor (PrRP) (Prolactin-releasinghormone) [Contains: Prolactin-releasing peptide PrRP31; Prolactin-releasing peptide PrRP20].
Source organism	Rattus norvegicus (Rat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	N/A
Tissue Specificity	Widely expressed, with highest levels in medulla oblongata and hypothalamus
Post translational modification	N/A
Function	Stimulates prolactin (PRL) release and regulates the expression of prolactin through its receptor GPR10. May stimulate lactotrophs directly to secrete PRL
Protein Length	83 Amino acids
Molecular weight	9215
References	1  PubMed abstract 9607765 2  PubMed abstract 11178959 3   Anderson S.T., Kokay I.C., Lang T., Grattan D.R., Curlewis J.D.; "Quantitation of prolactin-releasing peptide (PrRP) mRNA expression inspecific brain regions during the rat oestrous cycle and inlactation."; Submitted (JUN-2002) to the EMBL/GenBank/DDBJ databases. 4  PubMed abstract 10498338
Domain Name	N/A
Hormone Name	Prolactin-releasing peptide PrRP31
Mature Hormone Sequence	SRAHQHSMETRTPDINPAWYTGRGIRPVGRF
Position of mature hormone in Pre-Hormone protein	31 Residues from position (22-52)
Receptor	Q64121    Detail in HMRbase
Gene ID	63850
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 2

HMRbase accession number	10307
Swiss-prot Accession number	P81278 (Sequence in FASTA format)
Description	Prolactin-releasing peptide precursor (PrRP) (Prolactin-releasinghormone) [Contains: Prolactin-releasing peptide PrRP31; Prolactin-releasing peptide PrRP20].
Source organism	Rattus norvegicus (Rat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	N/A
Tissue Specificity	Widely expressed, with highest levels in medulla oblongata and hypothalamus
Post translational modification	N/A
Function	Stimulates prolactin (PRL) release and regulates the expression of prolactin through its receptor GPR10. May stimulate lactotrophs directly to secrete PRL
Protein Length	83 Amino acids
Molecular weight	9215
References	1  PubMed abstract 9607765 2  PubMed abstract 11178959 3   Anderson S.T., Kokay I.C., Lang T., Grattan D.R., Curlewis J.D.; "Quantitation of prolactin-releasing peptide (PrRP) mRNA expression inspecific brain regions during the rat oestrous cycle and inlactation."; Submitted (JUN-2002) to the EMBL/GenBank/DDBJ databases. 4  PubMed abstract 10498338
Domain Name	N/A
Hormone Name	Prolactin-releasing peptide PrRP20
Mature Hormone Sequence	TPDINPAWYTGRGIRPVGRF
Position of mature hormone in Pre-Hormone protein	20 Residues from position (33-52)
Receptor	Q64121    Detail in HMRbase
Gene ID	63850
PDB ID	N/A
Drugpedia	wiki
Comments