| HMRbase accession number | 11506 |
| Swiss-prot Accession number | Q86YW7 (Sequence in FASTA format) |
| Description | Glycoprotein hormone beta-5 precursor (Thyrostimulin subunit beta). |
| Source organism | Homo sapiens (Human) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | Highly expressed in brain and at low levels in pituitary. Also found in retina, testis and skin but not in pancreas, parotid, kidney, stomach, liver, colon, small intestine, thyroid, brain or adrenal gland. In pituitary, colocalizes with ACTH, suggesting that it is located in corticotrophs |
| Post translational modification | N-glycosylated. |
| Function | Stimulates the thyroid. Binds and activates THSR, leading to increased cAMP production |
| Protein Length | 130 Amino acids |
| Molecular weight | 14232 |
| References | 1 PubMed abstract 12045258 2 Holloway J.L., O'Hogan S.L., Tackett M., Taft D., Thayer E.C.,Webster P.; "A novel glycoprotein hormone beta subunit."; Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases.
3 PubMed abstract 12508121 4 PubMed abstract 15489334 5 PubMed abstract 12089349 6 PubMed abstract 16210345
|
| Domain Name | Cys_knot |
| Hormone Name | Glycoprotein hormone beta-5 |
| Mature Hormone Sequence | ASSGNLRTFVGCAVREFTFLAKKPGCRGLRITTDACWGRCETWEKPILEPPYIEAHHRVCTYNETKQVTVKLPNCAPGVDPFYTYPVAIRCDCGACSTATTECETI |
| Position of mature hormone in Pre-Hormone protein | 106 Residues from position (25-130) |
| Receptor | P16473
Detail in HMRbase
|
| Gene ID | 122876 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | |