A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10345 |
| Swiss-prot Accession number | Q96T91 (Sequence in FASTA format) |
| Description | Glycoprotein hormone alpha-2 precursor (Thyrostimulin subunit alpha). |
| Source organism | Homo sapiens (Human) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
| Tissue Specificity | Found in a variety of tissues |
| Post translational modification | Glycosylated. |
| Function | Stimulates the thyroid. Binds and activates THSR, leads to increased cAMP production |
| Protein Length | 129 Amino acids |
| Molecular weight | 14163 |
| References | 1 Ching A., Gilbert T., Lok S., Sheppard P., Webster P., O'Hara P.J.; "A novel cysteine knot protein expressed in pancreatic acinar cells."; Submitted (APR-2000) to the EMBL/GenBank/DDBJ databases.
2 PubMed abstract 15489334 3 PubMed abstract 12045258 4 PubMed abstract 12089349 |
| Domain Name | N/A |
| Hormone Name | Glycoprotein hormone alpha-2 |
| Mature Hormone Sequence | QEAVIPGCHLHPFNVTVRSDRQGTCQGSHVAQACVGHCESSAFPSRYSVLVASGYRHNITSVSQCCTISGLKKVKVQLQCVGSRREELEIFTARACQCDMCRLSRY |
| Position of mature hormone in Pre-Hormone protein | 106 Residues from position (24-129) |
| Receptor | P16473
Detail in HMRbase |
| Gene ID | 170589 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |