A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10316 |
| Swiss-prot Accession number | Q04618 (Sequence in FASTA format) |
| Description | Corticotropin-lipotropin B precursor (Pro-opiomelanocortin B) (POMC B)[Contains: NPP 2; Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha 2 (Alpha-MSH 2); Corticotropin-like intermediarypeptide 2 (CLIP-2); Lipotropin beta (Beta-LPH); Lipotropin gamma(Gamma-LPH); Melanotropin beta 2 (Beta-MSH 2); Beta-endorphin 2; Met-enkephalin]. |
| Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
| Subcellular location | N/A |
| Developmental Stage | Expressed only in sexually active fish. |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | Pituitary and hypothalamus of adult diploid animals |
| Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. Acetylation of beta-endorphin occurs in a tissue-specific manner. |
| Function | N/A |
| Protein Length | 240 Amino acids |
| Molecular weight | 26719 |
| References | 1 PubMed abstract 1448114 2 PubMed abstract 1448114 |
| Domain Name | ACTH_domain NPP Op_neuropeptide |
| Hormone Name | Lipotropin beta (Beta-LPH) |
| Mature Hormone Sequence | QLSSWEDEMVGALGNQGAKAQTKVVPRTLTVTGLQDKKDGSYRMGHFRWGSPTAIKRYGGFMKPYTQQSHKPLITLLKHVTLKNEQ |
| Position of mature hormone in Pre-Hormone protein | 86 Residues from position (155-240) |
| Receptor | Q6QLQ0 Detail in HMRbase Q6QLQ1 Detail in HMRbase |
| Gene ID | 100136772 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |