A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10334 |
| Swiss-prot Accession number | Q8CIT0 (Sequence in FASTA format) |
| Description | Corticoliberin precursor (Corticotropin-releasing factor) (CRF)(Corticotropin-releasing hormone). |
| Source organism | Mus musculus (Mouse) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | This hormone from hypothalamus regulates the release of corticotropin from pituitary gland |
| Protein Length | 187 Amino acids |
| Molecular weight | 20778 |
| References | 1 Seasholtz A.F., Bourbonais F.J., Harnden C.E., Camper S.A.; "Nucleotide sequence and expression of the mouse corticotropin-releasing hormone gene."; Mol. Cell. Neurosci. 2:266-273(1991).
|
| Domain Name | CRF |
| Hormone Name | Corticoliberin |
| Mature Hormone Sequence | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII |
| Position of mature hormone in Pre-Hormone protein | 41 Residues from position (145-185) |
| Receptor | P35347 Detail in HMRbase Q60748 Detail in HMRbase |
| Gene ID | 12918 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |