A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11301 |
| Swiss-prot Accession number | P01217 (Sequence in FASTA format) |
| Description | Glycoprotein hormones alpha chain precursor (Anterior pituitaryglycoprotein hormones common subunit alpha) (Follitropin alpha chain)(Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alphachain) (Luteinizing hormone alpha chain) (LSH-alpha) (Thyrotropinalpha chain) (Thyroid-stimulating hormone alpha chain) (TSH-alpha). |
| Source organism | Bos taurus (Bovine) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | N/A |
| Protein Length | 120 Amino acids |
| Molecular weight | 13616 |
| References | 1 PubMed abstract 6314263 2 PubMed abstract 6688736 3 PubMed abstract 6187740 4 PubMed abstract 5101174 5 PubMed abstract 5101175 6 PubMed abstract 5107231 7 PubMed abstract 4854483 8 PubMed abstract 6314263 9 PubMed abstract 6688736 10 PubMed abstract 6187740 11 PubMed abstract 5101174 12 PubMed abstract 5101175 13 PubMed abstract 5107231 14 PubMed abstract 4854483 |
| Domain Name | Hormone_6 |
| Hormone Name | Glycoprotein hormones alpha chain |
| Mature Hormone Sequence | FPDGEFTMQGCPECKLKENKYFSKPDAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNVRVENHTECHCSTCYYHKS |
| Position of mature hormone in Pre-Hormone protein | 96 Residues from position (25-120) |
| Receptor | P35376 Detail in HMRbase Q28005 Detail in HMRbase Q27987 Detail in HMRbase |
| Gene ID | 280749 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |