A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11303 |
| Swiss-prot Accession number | P01219 (Sequence in FASTA format) |
| Description | Glycoprotein hormones alpha chain precursor (Anterior pituitaryglycoprotein hormones common subunit alpha) (Follitropin alpha chain)(Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alphachain) (Luteinizing hormone alpha chain) (LSH-alpha) (Thyrotropinalpha chain) (Thyroid-stimulating hormone alpha chain) (TSH-alpha). |
| Source organism | Sus scrofa (Pig) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | N/A |
| Protein Length | 120 Amino acids |
| Molecular weight | 13532 |
| References | 1 PubMed abstract 2473932 2 Kato Y., Ezashi T., Hirai T., Kato T.; Submitted (MAR-1992) to the EMBL/GenBank/DDBJ databases. 3 PubMed abstract 4770796 4 Closset J., Maghuin-Rogister G., Hennen G.; Endocrinol. Exp. 8:164-164(1974). 5 PubMed abstract 4448287 6 PubMed abstract 2473932 7 Kato Y., Ezashi T., Hirai T., Kato T.; Submitted (MAR-1992) to the EMBL/GenBank/DDBJ databases. 8 PubMed abstract 4770796 9 Closset J., Maghuin-Rogister G., Hennen G.; Endocrinol. Exp. 8:164-164(1974). 10 PubMed abstract 4448287 |
| Domain Name | Hormone_6 |
| Hormone Name | Glycoprotein hormones alpha chain |
| Mature Hormone Sequence | FPDGEFTMQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNARVENHTECHCSTCYYHKS |
| Position of mature hormone in Pre-Hormone protein | 96 Residues from position (25-120) |
| Receptor | P49059 Detail in HMRbase P16582 Detail in HMRbase Q8SPP9 Detail in HMRbase |
| Gene ID | 406869 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |