A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11391 |
| Swiss-prot Accession number | P09240 (Sequence in FASTA format) |
| Description | Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 33(CCK33); Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)]. |
| Source organism | Mus musculus (Mouse) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the gastrin/cholecystokinin family. |
| Tissue Specificity | N/A |
| Post translational modification | The precursor cleaved by enzymes to produce a number of active cholecystokinins. |
| Function | This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion |
| Protein Length | 115 Amino acids |
| Molecular weight | 12866 |
| References | 1 PubMed abstract 2011497 2 PubMed abstract 3862083 |
| Domain Name | Gastrin |
| Hormone Name | Cholecystokinin-33 |
| Mature Hormone Sequence | KAPSGRMSVLKNLQSLDPSHRISDRDYMGWMDF |
| Position of mature hormone in Pre-Hormone protein | 33 Residues from position (71-103) |
| Receptor | P56481 Detail in HMRbase O08786 Detail in HMRbase Q3TPL0 Detail in HMRbase Q3ZB46 Detail in HMRbase Q3ZB53 Detail in HMRbase Q8BKF6 Detail in HMRbase |
| Gene ID | 12424 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |