A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11477 |
| Swiss-prot Accession number | P55095 (Sequence in FASTA format) |
| Description | Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)]. |
| Source organism | Mus musculus (Mouse) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain |
| Post translational modification | Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity). |
| Function | Oxyntomodulin significantly reduces food intake |
| Protein Length | 180 Amino acids |
| Molecular weight | 20906 |
| References | 1 PubMed abstract 7730317 2 Shamsadin R., Knepel W.; "Mouse glucagon full length cDNA."; Submitted (JUN-2000) to the EMBL/GenBank/DDBJ databases. 3 PubMed abstract 16141072 4 PubMed abstract 15489334 5 PubMed abstract 1886889 6 PubMed abstract 9407057 7 PubMed abstract 11356850 8 PubMed abstract 12554744 9 PubMed abstract 12626323 10 PubMed abstract 10322410 11 PubMed abstract 10605628 |
| Domain Name | Hormone_2 |
| Hormone Name | Oxyntomodulin |
| Mature Hormone Sequence | KRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA |
| Position of mature hormone in Pre-Hormone protein | 37 Residues from position (53-89) |
| Receptor | Q61606 Detail in HMRbase Q3UN81 Detail in HMRbase |
| Gene ID | 14526 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |