A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11520 |
| Swiss-prot Accession number | Q9YGP3 (Sequence in FASTA format) |
| Description | Glycoprotein hormones alpha chain precursor (Gonadotropin alpha chain)(GTH-alpha). |
| Source organism | Ictalurus punctatus (Channel catfish) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Siluriformes;Ictaluridae; Ictalurus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Involved in gametogenesis and steroidogenesis |
| Protein Length | 116 Amino acids |
| Molecular weight | 13089 |
| References | 1 PubMed abstract 9284560 |
| Domain Name | Hormone_6 |
| Hormone Name | Glycoprotein hormones alpha chain |
| Mature Hormone Sequence | FPNNDFGCEECKLKENNIFSKPGAPVYQCMGCCFSRAYPTPLRSEKTMLVPKNITSEATCCVAKEVKRVIVNDVKLMNHTDCHCSTCYYHKF |
| Position of mature hormone in Pre-Hormone protein | 92 Residues from position (25-116) |
| Receptor | Q6QMG1 Detail in HMRbase Q98T84 Detail in HMRbase Q98T85 Detail in HMRbase |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |