A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10004 |
| Swiss-prot Accession number | P81880 (Sequence in FASTA format) |
| Description | Glucagon precursor [Contains: Glucagon; Glucagon-like peptide](Fragment). |
| Source organism | Piaractus mesopotamicus (Pacu) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Characiformes;Characidae; Piaractus. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | N/A |
| Protein Length | 71 Amino acids |
| Molecular weight | 8155 |
| References | 1 PubMed abstract 10327603 |
| Domain Name | Hormone_2 |
| Hormone Name | Glucagon-like peptide |
| Mature Hormone Sequence | HADGTYTSDVSAYLQDQAAKDFITWLKSGQPKQE |
| Position of mature hormone in Pre-Hormone protein | 34 Residues from position (38-71) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |