A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10009 |
| Swiss-prot Accession number | P09682 (Sequence in FASTA format) |
| Description | Glucagon. |
| Source organism | Hydrolagus colliei (Spotted ratfish) (Pacific ratfish) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Holocephali; Chimaeriformes; Chimaeridae; Hydrolagus. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | Produced by the X-cells of the islets of pancreas |
| Post translational modification | N/A |
| Function | Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level |
| Protein Length | 36 Amino acids |
| Molecular weight | 4236 |
| References | 1 PubMed abstract 3311036 |
| Domain Name | Hormone_2 |
| Hormone Name | Glucagon |
| Mature Hormone Sequence | HTDGIFSSDYSKYLDNRRTKDFVQWLLSTKRNGANT |
| Position of mature hormone in Pre-Hormone protein | 36 Residues from position (1-36) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |