A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10011 |
| Swiss-prot Accession number | P56618 (Sequence in FASTA format) |
| Description | Diuretic hormone 1 (Diuretic hormone I) (DH I) (Diuretic peptide I)(DP I) (DH(37)) (DH37). |
| Source organism | Tenebrio molitor (Yellow mealworm) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Coleoptera; Polyphaga; Cucujiformia;Tenebrionidae; Tenebrio. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Stimulates fluid secretion by the Malpighian tubules. Increases cyclic AMP production |
| Protein Length | 37 Amino acids |
| Molecular weight | 4371 |
| References | 1 PubMed abstract 8618894 2 PubMed abstract 11893763 |
| Domain Name | CRF |
| Hormone Name | Diuretic hormone 1 |
| Mature Hormone Sequence | SPTISITAPIDVLRKTWEQERARKQMVKNREFLNSLN |
| Position of mature hormone in Pre-Hormone protein | 37 Residues from position (1-37) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |