A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10025 |
| Swiss-prot Accession number | P48098 (Sequence in FASTA format) |
| Description | Peptide YY-like precursor (PYY). |
| Source organism | Lampetra fluviatilis (River lamprey) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia;Petromyzontiformes; Petromyzontidae; Lampetra. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the NPY family. |
| Tissue Specificity | Gut and medial reticulospinal neuron system in the brainstem |
| Post translational modification | N/A |
| Function | Gastrointestinal hormone and neuropeptide |
| Protein Length | 93 Amino acids |
| Molecular weight | 10551 |
| References | 1 PubMed abstract 8028041 |
| Domain Name | Hormone_3 |
| Hormone Name | Peptide YY-like |
| Mature Hormone Sequence | FPPKPDNPGDNASPEQMARYKAAVRHYINLITRQRY |
| Position of mature hormone in Pre-Hormone protein | 36 Residues from position (28-63) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |