A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10057 |
| Swiss-prot Accession number | Q27IM2 (Sequence in FASTA format) |
| Description | Parathyroid hormone precursor (Parathyrin) (PTH). |
| Source organism | Equus caballus (Horse) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus. |
| Subcellular location | Secreted protein (By similarity) |
| Developmental Stage | N/A |
| Similarity | Belongs to the parathyroid hormone family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion |
| Protein Length | 115 Amino acids |
| Molecular weight | 13062 |
| References | 1 Rourke K.M., Kohn C.W., Rosol T.J., Toribio R.E.; Submitted (FEB-2006) to the EMBL/GenBank/DDBJ databases.
2 Shiue Y.-L., Caetano A.R., Lyons L.A., O'Brien S.J., Laughlin T.F.,Murray J.D., Bowling A.T.; Submitted (MAR-1999) to the EMBL/GenBank/DDBJ databases. |
| Domain Name | Parathyroid |
| Hormone Name | Parathyroid hormone (Parathyrin) (PTH) |
| Mature Hormone Sequence | SVSEIQLMHNLGKHLNSVERVEWLRKKLQDVHNFIALGAPIFHRDGGSQRPRKKEDNVLIESHQKSLGEADKADVDVLSKTKSQ |
| Position of mature hormone in Pre-Hormone protein | 84 Residues from position (32-115) |
| Receptor | N/A |
| Gene ID | 100034104 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |