A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10084 |
| Swiss-prot Accession number | Q9XT35 (Sequence in FASTA format) |
| Description | Parathyroid hormone precursor (Parathyrin) (PTH). |
| Source organism | Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the parathyroid hormone family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion |
| Protein Length | 115 Amino acids |
| Molecular weight | 12890 |
| References | 1 Malaivijitnond S., Takenaka O.; "Nucleotide sequences of parathyroid gene in five species of macaqueof Thailand."; J. Sci. Res. Chulalongkorn Univ. 23:135-142(1998).
|
| Domain Name | Parathyroid |
| Hormone Name | Parathyroid hormone (Parathyrin) (PTH) |
| Mature Hormone Sequence | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFIALGAPLAPRDAGSQRPRKKEDNILVESHEKSLGEADKADVDVLTKAKSQ |
| Position of mature hormone in Pre-Hormone protein | 84 Residues from position (32-115) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |