A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10097 |
| Swiss-prot Accession number | P83486 (Sequence in FASTA format) |
| Description | Crustacean hyperglycemic hormone B (CHHB). |
| Source organism | Cherax destructor (Yabbie) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Astacidea;Parastacoidea; Parastacidae; Cherax. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | N/A |
| Post translational modification | Stereoinversion of L-Phe (in CHHB-I) to D-Phe (in CHHB-II). |
| Function | Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction |
| Protein Length | 72 Amino acids |
| Molecular weight | 8395 |
| References | 1 PubMed abstract 15127939 |
| Domain Name | Crust_neurohorm |
| Hormone Name | Crustacean hyperglycemic hormone B |
| Mature Hormone Sequence | QVFDQACKGVYDRAIFKKLDRVCDDCYNLYRKPYVATSCRQNCYSNLVFRQCLDDLLLVDVVDEYVSGVQIV |
| Position of mature hormone in Pre-Hormone protein | 72 Residues from position (1-72) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |