A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10101 |
| Swiss-prot Accession number | Q25683 (Sequence in FASTA format) |
| Description | Crustacean hyperglycemic hormones precursor [Contains: CHH precursor-related peptide (CPRP); Crustacean hyperglycemic hormone (CHH)]. |
| Source organism | Procambarus clarkii (Red swamp crayfish) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Astacidea;Astacoidea; Cambaridae; Procambarus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released |
| Post translational modification | N/A |
| Function | Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction |
| Protein Length | 137 Amino acids |
| Molecular weight | 15264 |
| References | 1 Yasuda-Kamatani Y., Yasuda A.; "Crustacean hyperglycemic hormone precursor from Procambarusclarkii."; Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases.
2 Kang W.; Submitted (MAR-1993) to the EMBL/GenBank/DDBJ databases. 3 PubMed abstract 7821776 |
| Domain Name | Crust_neurohorm |
| Hormone Name | Crustacean hyperglycemic hormone |
| Mature Hormone Sequence | QVFDQACKGIYDRAIFKKLDRVCEDCYNLYRKPYVATTCRQNCYANSVFRQCLDDLLLIDVVDEYISGVQTV |
| Position of mature hormone in Pre-Hormone protein | 72 Residues from position (64-135) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |