A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10102 |
| Swiss-prot Accession number | Q14406 (Sequence in FASTA format) |
| Description | Chorionic somatomammotropin hormone-like 1 precursor (Chorionicsomatomammotropin-like) (Lactogen-like). |
| Source organism | Homo sapiens (Human) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | May be a novel gestational hormone required to compensate for absence of other members of the GH/CS cluster during gestation |
| Protein Length | 199 Amino acids |
| Molecular weight | 22649 |
| References | 1 PubMed abstract 2744760 2 PubMed abstract 8083227 |
| Domain Name | Hormone_1 |
| Hormone Name | Chorionic somatomammotropin hormone-like 1 |
| Mature Hormone Sequence | VQTVPLSRLFKEAMLQAHRAHQLAIDTYQEFISSWGMDSIPTSSNMEETQQKSNLELLHISLLLIESRLEPVRFLRSTFTNNLVYDTSDSDDYHLLKDLEEGIQMLMGRLEDGSHLTGQTLKQTYSKFDTNSHNHDALLKNYGLLHCFRKDMDKVETFLRMVQCRSVEGSCGF |
| Position of mature hormone in Pre-Hormone protein | 173 Residues from position (27-199) |
| Receptor | N/A |
| Gene ID | 1444 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |