A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10103 |
| Swiss-prot Accession number | P82014 (Sequence in FASTA format) |
| Description | Diuretic hormone 1 (DH-1) (Diuretic peptide 1) (DP-1) (DH(41)). |
| Source organism | Hyles lineata (Whitelined sphinx moth) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Sphingoidea;Sphingidae; Macroglossinae; Hyles. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Regulation of fluid secretion. May stimulate primary urine secretion by Malpighian tubules and causes a dose-dependent stimulation of cAMP levels in the tubules |
| Protein Length | 41 Amino acids |
| Molecular weight | 4724 |
| References | 1 PubMed abstract 10696588 |
| Domain Name | CRF |
| Hormone Name | Diuretic hormone 1 |
| Mature Hormone Sequence | RMPSLSIDLPMSVLRQKLSLEKERKVQALRAAANRNFLNDI |
| Position of mature hormone in Pre-Hormone protein | 41 Residues from position (1-41) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |